PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_023785-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 327aa    MW: 36029.9 Da    PI: 7.6917
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_023785-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.8e-33182239259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCts++C+vkk+vers +dp++v++tYeg+H+h+
  NNU_023785-RA 182 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCSVKKRVERSVQDPSIVITTYEGQHTHQ 239
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-35166241IPR003657WRKY domain
SuperFamilySSF1182903.14E-29173241IPR003657WRKY domain
PROSITE profilePS5081131.651176241IPR003657WRKY domain
SMARTSM007745.0E-39181240IPR003657WRKY domain
PfamPF031061.6E-26182239IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSDEARDLYH LDPFYDYHRN VGRSGFPFSA DHPSMYNQSG HGLGDSSAND LPGFGPSYMS  60
FTECLHGAMD YSTLSRAFDF SCSSPDVLYP VDDAGQKGAG TGESVGTGDI PATPNSSVSS  120
SSSESAGEGE DSGKSKKDRQ PKGSEDAVDK SKKVNKPKKK GEKRQREPRF AFMTKSEVDH  180
LEDGYRWRKY GQKAVKNSPY PRSYYRCTSQ KCSVKKRVER SVQDPSIVIT TYEGQHTHQC  240
PATLRGHNTS STGMMTPSML AVPPSAGSMF PQELLVQLPS TNNQGGTGSI FQQNLTHHHI  300
PHIQQLQLPD YGLLQDIVPS FIHRQQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-28171242778Probable WRKY transcription factor 4
2lex_A5e-28171242778Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243705.10.0PREDICTED: probable WRKY transcription factor 28
TrEMBLA0A061DK581e-119A0A061DK58_THECC; WRKY DNA-binding protein 28, putative
STRINGVIT_12s0028g00270.t011e-114(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.13e-54WRKY DNA-binding protein 28